Finlayson Fan @FinlaysonFan
In honour of comedian James Finlayson 1887-1953. DOHHH. Mostly film and TV related things but not exclusively. Laurel and Hardy Movies Joined February 2014-
Tweets2K
-
Followers243
-
Following282
-
Likes2K
Finlayson Fan retweeted
0
3
2
140
0
View Details
Finlayson Fan retweeted
Finlayson Fan retweeted
Laurel and Hardy Open The Romney Hythe Dymchurch Railway (1947)
Finlayson Fan retweeted
@jk_rowling How about this to get the ball rolling? #HarryPotter #jkrowling
Finlayson Fan retweeted
#nursesstrike #rcn #NHS #keirstarmer #labour Just imagine that Benny Hill music…
Finlayson Fan retweeted
Wee Ollie (George 'Spanky' McFarland), Big Ollie & Stan... #LaurelAndHardy #StanLaurel #StanAndOllie #OliverHardy #SpankyMcFarland @ArthurStanleyJ @ONorvellHardy
😂😂😂
@ZackPolanski Back Zack & Crack seems to have clit spanners top and bottom. Unusual.
Finlayson Fan retweeted
'Fin' returns to the Dobbie Hall, in his home town of Larbert Scotland, in the form of an artwork. heraldscotland.com/news/25000573.…
Finlayson Fan retweeted
BEFORE THEY WERE FAMOUS - Laurel and Hardy
Finlayson Fan retweeted
“It was an honour." Fresh recognition for James Finleyson, who gave Homer his 'D'oh' heraldscotland.com/news/25000573.…
Finlayson Fan retweeted
Back to school. #LaurelAndHardy
Finlayson Fan retweeted
Have you been burning the candle at both ends? Too much of the high life? Decided against moving down to the basement & instead heading to the mountains & high multitudes with your caravan / trailer this weekend? #LaurelAndHardy #StanAndOllie #StanLaurel #OliverHardy
If you are thinking of heading into the hills and mountains this weekend, don’t forget to check our mountain forecasts before packing your rucksack to help you plan a safe visit 👇 #WeatherReady
@StrangeReg1 @AllisonPearson I’m not sure about Starmer’s clear mandate in terms of public support but he did get a huge majority in the HOCs.
Finlayson Fan retweeted
That, @VictoriaCoren is the funniest article I’ve read all year! Happy Christmas 🎄 telegraph.co.uk/tv/0/gavin-sta…
Finlayson Fan retweeted
@salltweets Never sticks at anything that Mr Wu. First runs a laundry, then becomes a window cleaner, now this! youtu.be/3w3X95uWv8A?si…
Finlayson Fan retweeted
Don't try this at home folks! #LaurelAndHardy #StanAndOllie #StanLaurel #OliverHardy @ArthurStanleyJ @ONorvellHardy
Finlayson Fan retweeted
Happy Halloween to laughter fans around the world! Try not to have nightmares... 🎃💀👻 #LaurelAndHardy #StanAndOllie #StanLaurel #OliverHardy @ArthurStanleyJ @ONorvellHardy
Finlayson Fan retweeted
The Last of the Summer Wine for #KeirStarmer & #AngelaRayner
Laurel & Hardy News @laurelHardyNews
2K Followers 304 Following The latest News, information & history relating to The Kings Of Comedy, Laurel and Hardy. Support - https://t.co/43UQLKNt8S #LaurelAndHardy #StanAndOllie
Talking Pictures TV @TalkingPicsTV
76K Followers 2K Following Archive TV Channel. Keeping celluloid alive! Freeview82 Freesat306 Sky324 Virgin445 Freely36. FREE catch-up via Freeview Red Button and https://t.co/asFAv1JEmA
The Laurel & Hardy Po... @HardyBlog
524 Followers 152 Following Entertaining & informative discussions abound as host Patrick Vasey and the world's top experts take a chronological deep dive into the world of Laurel & Hardy.
Buster Keaton @BusterKeatonSoc
19K Followers 5K Following The International Buster Keaton Society, celebrating over 30 years honoring the life and work of Buster Keaton https://t.co/ayQtcfktG0
James Henderson Finla... @JamesHFinlayson
359 Followers 99 Following Born in Larbert, Scotland. Exasperated by Stan Laurel & Oliver Hardy. Doooohhhhh! Tribute to the master of the 'double take'.
Oliver Norvell Hardy @ONorvellHardy
688 Followers 87 Following Tribute to Oliver Norvell Hardy. Master of the exasperated look. One half of Laurel and Hardy. https://t.co/UtzdCjVCns #OliverHardy #LaurelAndHardy
Arthur Stanley Laurel... @ArthurStanleyJ
732 Followers 114 Following Tribute to Arthur Stanley Jefferson, comedy genius, Stan Laurel. Half of legends Laurel & Hardy. https://t.co/zVtUnnjj9p #StanLaurel #LaurelAndHardy.
BusterLove @busterlove1895
6K Followers 2K Following Buster Keaton tweets for fans by a fan. Spreading the #BusterLove🍀
Classic Movie Hub @ClassicMovieHub
114K Followers 23K Following The Classic Movie Cheerleader! #ALWAYSClassic • Co-founder of #ClassicMovies & More on #Youtube • Social Producer for #TCMFF @TCM Film Fest • #TCMFFSP
Ben Model @silentfilmmusic
4K Followers 2K Following Silent film accompanist bringing silent movies to life since 1981; Blu-ray/DVD prod/distrib @undercrankprod since 2013; Ernie Kovacs TV archivist
Brian @B32533783Brian
98 Followers 3K Following
MaxDovahSix @MaxDovahSix
161 Followers 453 Following "Non si possono scoprire nuovi oceani, se non si ha il coraggio di lasciarsi alle spalle il porto." (Anonimo)
Lexia Roy @lexia3456
131 Followers 7K Following Greetings, my friend! 🚢⚓ I deal in fine vessels both large and small — cargo ships, fishing trawlers, luxury yachts, and sturdy riverboats. Every ship I offer
Roberto @speedyhx5
0 Followers 679 Following
Ned Smailes @ned_smailes
3 Followers 273 Following
colin welsh (welshy) @ColinWelsh1963
46 Followers 536 Following Liverpool FC, mod revival, northern soul, retired train driver, ex British rail, 60s soul, mod.
Manning Glover @manning_gl37635
73 Followers 2K Following 20 year old kid like Lego and go to Piedmont high school and like to go bow
Arthur @arthursdug
1K Followers 4K Following Musicrunningdugswalkingvegancyclinggymchesspoliticsmountainsbeercarslaurelnhardysnowboardingmorerunningthe smoutgardeningmorerunningradiopresenter
Walter J. Gallo @Gallo67238J
153 Followers 3K Following
Lauren Thomson @LaurenThom72132
142 Followers 1K Following
not in use @MDVWJC12
151 Followers 973 Following
Chartersand Caldicot @ChartersandC
1K Followers 1K Following Charters and Caldicott, the two lovable upper class Englishmen who appeared in classic movies - The Lady Vanishes, Night Train to Munich, Crook's Tour and more
Jan Houghtaling @HoughtalingJan
568 Followers 732 Following
Mathias Jacobs @MathiasJac32431
3 Followers 124 Following
MaxBoxing Live @maxboxinglive
1K Followers 98 Following https://t.co/oW7I8HxA0P brings you LIVE round by round coverage.
⚜️ 𝕲𝖑𝖊�... @gwebbie101
1K Followers 4K Following 🎬 Supporting Artiste 🎭 https://t.co/oyF04OImhb https://t.co/0nWdj2Ec5M ⚜️𝕿𝖚𝖉𝖔𝖗 𝕳𝖎𝖘𝖙𝖔𝖗𝖞⚜️ MADNESS 🎷 MODE 🎹 NUMAN 🎸𝓐𝓻𝓼𝓮𝓷𝓪𝓵🔴⚪️
SleepingMind @SleepingMind64
8 Followers 220 Following
George Flayheath 🇨... @gruntydumpkins
46 Followers 96 Following
James Thompson @jfthompson7
2 Followers 58 Following
Allen Mills @AllenMills74203
15 Followers 255 Following
Hertheigh @HertheighZ_z
67 Followers 1K Following
FindingHatsOff @FindingHatsOff
44 Followers 71 Following The 'Holy Grail' of #LaurelAndHardy films, 'Hats Off', is missing. Help find it before it turns 100 in 2027. Contact us with any info on the film's location.
Len Simpkins @d78863cb4bbd495
9 Followers 120 Following
David Young @DavidYo97236494
82 Followers 330 Following
Laurel Stumpf @laurelsmusic5
370 Followers 473 Following Singer, Songwriter, Composer, Musician-Guitar, Bass, Piano 🎼🎶🎵🎤🎸🎹🥁 Xenite🗡️⚔️📜
A Lot of Fun Writers @lotoffunwriters
24 Followers 76 Following Research and discoveries into the lives and careers of the writers at Hal Roach Studios. 🎬🎞️ #LaurelandHardy #CharleyChase #OurGang #ThelmaTodd #HalRoach
The Three Stooges @thethreestooges
17K Followers 848 Following The Three Stooges official Twitter. Nyuk, Nyuk, Nyuk!
Curlys Grandson @grandstooge
2K Followers 195 Following Brad Server Youngest Grandson of Curly Howard
Maclay's Alloa Ales @MaclayAlloaAles
103 Followers 291 Following James Maclay (brewer of great repute). Est. 1830. In 1870 James built the Thistle Brewery in Alloa, Scotland. * Not an official Maclay account *.
Chris Scheer @Fuzzaldrin
296 Followers 1K Following Married to the beautiful and funny @MS_cheerTX, two beautiful and crazy kiddos, #Astros fan since 1983, and proud Fightin' Texas A&M #Aggie, class of '97!
Alan Uttley @AlanUttley
5 Followers 33 Following
David Welsh @DavieWelsh1960
0 Followers 73 Following
robert body @robertbody1
275 Followers 5K Following
Educorp @Educorp3
263 Followers 5K Following
Bill Horan @BillHoran1
665 Followers 653 Following a double bed and a stalwart lover for sure, these are the riches of the poor.
Judge Smails @DevonScouser
2K Followers 3K Following Liverpool FC fan YNWA. Endo and Chiesa fanboy. Gamer PS5 and PC ❤️ Low tolerance of snake oil salesmen
Max Scott @MaxFalconScott
919 Followers 3K Following Husband, Father, Son, Petrol-Head, Music Lover, writer, amateur photographer, has Multi Morbidity, sometimes passionately serious, other times daft as a brush.
Dave @MUFC60
23 Followers 70 Following
Carmela @Carmelaartyes
12 Followers 517 Following Teaching Artist (retired), Associate Adjunct Professor, School of The Art Institute of Chicago, Writer, Critic, Artist.
KTJ @NewtonHeath99
0 Followers 3K Following
Mani Braich @ManiBraich
396 Followers 947 Following
Plissken @splisskem
569 Followers 3K Following “Whenever you find yourself on the side of the majority, it's time to pause and reflect.” @splisskem.bsky.social
Laurel and Hardy @Stan_And_Ollie
80K Followers 434 Following Keeping the memory and works of Laurel & Hardy alive for future generations to enjoy.
Laurel & Hardy News @laurelHardyNews
2K Followers 304 Following The latest News, information & history relating to The Kings Of Comedy, Laurel and Hardy. Support - https://t.co/43UQLKNt8S #LaurelAndHardy #StanAndOllie
Talking Pictures TV @TalkingPicsTV
76K Followers 2K Following Archive TV Channel. Keeping celluloid alive! Freeview82 Freesat306 Sky324 Virgin445 Freely36. FREE catch-up via Freeview Red Button and https://t.co/asFAv1JEmA
The Laurel & Hardy Po... @HardyBlog
524 Followers 152 Following Entertaining & informative discussions abound as host Patrick Vasey and the world's top experts take a chronological deep dive into the world of Laurel & Hardy.
Old Hollywood @TheOldHollywood
74K Followers 1K Following Classic cinema, music and television — from Hollywood and beyond — with flashes forward in between. Curated by @dav1drush. IG/TT/YT: tooldhollywoodandbeyond
Buster Keaton @BusterKeatonSoc
19K Followers 5K Following The International Buster Keaton Society, celebrating over 30 years honoring the life and work of Buster Keaton https://t.co/ayQtcfktG0
James Henderson Finla... @JamesHFinlayson
359 Followers 99 Following Born in Larbert, Scotland. Exasperated by Stan Laurel & Oliver Hardy. Doooohhhhh! Tribute to the master of the 'double take'.
archivetvmusings @archivetvmus71
92K Followers 558 Following 'Our purpose is to amuse, simply to amuse. Nothing serious, nothing political.'
Oliver Norvell Hardy @ONorvellHardy
688 Followers 87 Following Tribute to Oliver Norvell Hardy. Master of the exasperated look. One half of Laurel and Hardy. https://t.co/UtzdCjVCns #OliverHardy #LaurelAndHardy
Noirchick In Old Holl... @Noirchick1
159K Followers 5K Following Old Hollywood-Vintage & Glamour Photos.Backstories. Noir/Pre-Code/Silent/Classic Film. Cocktails & sass with a dash of sarcasm by an elegant, quirky, kind soul.
Arthur Stanley Laurel... @ArthurStanleyJ
732 Followers 114 Following Tribute to Arthur Stanley Jefferson, comedy genius, Stan Laurel. Half of legends Laurel & Hardy. https://t.co/zVtUnnjj9p #StanLaurel #LaurelAndHardy.
Classic Movie Hub @ClassicMovieHub
114K Followers 23K Following The Classic Movie Cheerleader! #ALWAYSClassic • Co-founder of #ClassicMovies & More on #Youtube • Social Producer for #TCMFF @TCM Film Fest • #TCMFFSP
Ben Model @silentfilmmusic
4K Followers 2K Following Silent film accompanist bringing silent movies to life since 1981; Blu-ray/DVD prod/distrib @undercrankprod since 2013; Ernie Kovacs TV archivist
Hollywood Golden Age ... @HGACinema
83K Followers 379 Following A curated archive of classic Hollywood stars with authentic photos and video footage by the era's greatest photographers and filmmakers. Posts by Neil Macready.
Hollywood Yesterday�... @HollywoodYeste1
47K Followers 2K Following Olivia de Havilland, Maureen O’Hara, Lucille Ball, Ann Sheridan, James Stewart, Henry Fonda, Sidney Poitier, Diahann Carroll, Rita Hayworth, Doris Day…John 3:16
Jiaoying Summers @JiaoyingSummers
17K Followers 440 Following Comedy Tour Tickets⬇️ https://t.co/ijaq8So92D
🦩 Sally Thomsett �... @sallythomsett
20K Followers 339 Following BAFTA nominated actress for "The Railway Children" known for "Man About The House" and "The Straw Dogs" & many programmes since 1961.Please check IMDB 😅XxXxX😅
Callum Bruce SNP 🏴... @CallumBruceSNP
7K Followers 3K Following Constituency: Kiln & Lochmillar, social media spokesperson. Fighting to break up the UK. GERS denier and Europhile.
Cllr. Florence McHunt... @CllrMcHuntSNP
13K Followers 5K Following 68 years young. Councillor for Glendarroch & Isle of Struay. #BothVotesSNP #AbolishPrisons #FreeSchoolBags. Promoted by my Husband, Phil McHunt, of Parody Farm.
Female Celebrities @AdoreCelebs
13K Followers 1 Following Posting on my other account: @AdoreCelebsUK Fan account. Posting pictures of celebs in the public domain.
Charlie Hall @CharlieHallLH
163 Followers 65 Following Tribute to Birmingham, UK born, 'little nemesis' of Comedy Kings, #LaurelAndHardy.
Carry On QOTD @CarryonQOTD
4K Followers 77 Following Your daily dose of Carry On.... and On.... and On....
Dancer on Film @DancerOnFilm
88K Followers 618 Following Movie dance scenes. Created by @anteyhon. ☕ https://t.co/5kdpe6RM1d
Ana de Armas Updates @ArmasUpdates
63K Followers 66 Following Fan updates account for Academy Award nominee and movie star Ana de Armas
Boa Of Feathers @BoaofFeathers
578 Followers 150 Following @Zoesfeatherboa back up account. I will do the odd tweet but visit the main account for regular updates and day to day stuff.
Classic Horror Films @HorrorHammer1
144K Followers 87 Following The number one page for classic horror. online! We tribute all horror films made from 1896-1979 and more! Hosted by @bomberwho @lovesheenaxoxo
Cary Grant @ClassyCaryGrant
1K Followers 119 Following Everyone wants to be Cary Grant. Even I want to be Cary Grant! Jan. 18 1904--Nov 29 1986. Years active 1932--1966 #TCM #CaryGrant
Saucy Seventies Adven... @SaucySeventies
37K Followers 1K Following Celebrating the golden age of the great British sex comedy. God bless Barry Evans and Robin Askwith. And Barry Stokes, the Handyman. Too saucy for YouTube!
UKADS @ukads3
54K Followers 727 Following Celebrating UK TV advertisements from the 1960s to the early 2000s
Classic_Television_UK @Funny_Stuff_UK
15K Followers 878 Following A tribute to the golden age of British television.
Jim Davidson @JimDOfficial
197K Followers 754 Following The Official Twitter for comedian Jim Davidson. Agent: Chris Davis Management Ltd-Tel 01584819005 or [email protected] Subscribe now at https://t.co/s36XhYNgvA
American Watch Networ... @AmericannWatch
6K Followers 4K Following 🇺🇸 Independent news and analysis covering the United States and the Americas. Breaking news, politics, business, technology, and global developments. #AWN
Mavis Pike @mavis_pike2
442 Followers 64 Following Widow. Mother to Frank. Good friend to Arthur. Run around after the Home Guard and the other residents of Walmington on Sea #mumsarmy
Zoe's feather boa 19K @zoesfeatherboa
16K Followers 1K Following I'm the boa, not 'Zoe' TV/film celebrities etc (mostly 🇬🇧), delete on request. Doctor Who obsessive. Backup @boaoffeathers Instagram @zoesfeatherboa
gpsrs15 @gpsrs
35 Followers 3K Following
Private Joe Walker @PteJoeWalker
3K Followers 501 Following Private in Home Guard (Dad's Army). For all your essential supplies ring Walmington 238.
Dad's Army Fans @DadsArmyFans
10K Followers 482 Following Dedicated to the classic British comedy Dad's Army a sitcom about the Home Guard during the Second World War and still occasionally shown on @BBCTwo
Carry On Films @Carryon1960
5K Followers 77 Following All 1960's old classics tv shows, music. I'm a huge fan of the old Carry on films. Please feel free to follow me all about remembering the good old days. 😆
Victoria Mature @VictoriaMature
3K Followers 3K Following Life is too important to be taken seriously. -Wilde (I'm Victor Mature's daughter.) @VictorMatureNet https://t.co/UhQpIn74WS
Croft-com Mania @Croft_comHQ
2K Followers 8 Following A Twitter feed celebrating the comedy genius of David Croft OBE, Jimmy Perry OBE & Jeremy Lloyd OBE. The shows they wrote continue to make the world laugh.
Silent Laughter @silentlaughfest
148 Followers 68 Following Annual celebration of great & forgotten #silentfilm comedians, presented by Kennington Bioscope. Nov 11 2017 at The Cinema Museum
Nicholas Booth @Thievesbook
4K Followers 5K Following Nicholas Booth writes detective stories about spies, fraudsters & with @howellspace, looking for life on Mars https://t.co/RILd2IF8AS
Stevo @Tweeter_Stevo
271 Followers 1K Following I wouldn't be a member of a club that would have me as a member.
Liverpool Sabbath Fel... @LiverpoolSabba1
21 Followers 267 Following 7th day Sabbath observing Christians. Seeking the truth of scripture. To learn about our Lord and Saviour Jesus Christ.
Gideon Juckes @NerimaTeaClub
997 Followers 781 Following Tuba The Field https://t.co/R8JbRYCnJj FU-CHING-GIDO https://t.co/x5OOYFjbD3
Robert Scott @RobScott216
163 Followers 632 Following I'm just a regular fellow, step right up and call me speedy - Harold Lloyd (The Freshman) 1925
Chisbiz @chrischis72
34 Followers 1K Following
si @sjs40something
214 Followers 271 Following Love the Hammers, and a bit of non league ground hopping
Antonio Banegas @Antonio30176772
121 Followers 4K Following
Luis Velasco Arias �... @Luisacker
474 Followers 5K Following Berciano del Reino. Madridista-anticulé. #HalaMadrid Objetivismo. Individualismo. Liberalismo. Apasionado por el arte.
Nick Howell @Mrlimepickle
135 Followers 400 Following
Charlie Nelson🇺�... @onsilentscreen
1K Followers 2K Following #RejoinEU ・ Composer・film fan ・ dyslexic・autistic・film music blog https://t.co/3Hr8SPcTLT Views are my own.Trends for United States
You might like
Oliver Norvell Hardy
@ONorvellHardy
688 Followers
Mae Busch
@MaeBuschLH
146 Followers
James Henderson Finla...
@JamesHFinlayson
359 Followers
Laurel and Hardy Mag
@LaurelnHardyMag
5K Followers
Charlie Hall
@CharlieHallLH
163 Followers
Arthur Stanley Laurel...
@ArthurStanleyJ
732 Followers
Laurel & Hardy News
@laurelHardyNews
2K Followers
The Laurel & Hardy Po...
@HardyBlog
524 Followers
Chartersand Caldicot
@ChartersandC
1K Followers
JIMMYJAZZ aka Danny m...
@mufc44
2K Followers
Laurel and Hardy Brat...
@SOTD_brats_tent
235 Followers
Ash
@ashmoorhouse
587 Followers
Thomas Hughes 🐦...
@thughes_8
517 Followers